Human CellExp™ Cathepsin S, human recombinant

Biomolecule/Target: Cathepsin S

Synonyms: Cathepsin S, CTSS

Alternates names: Cathepsin S, CTSS

Taglines: A lysosomal cysteine protease participating in the degradation of antigenic proteins to peptides

Taglines: USA

Country of Animal Origin: USA

NCBI Gene ID #.: 1520

NCBI Gene Symbol: CTSS

Gene Source: Human

Accession #: P25774

Recombinant: Yes

Source: HEK 293 cells

Purity by SDS-PAGE #: ≥95%

Assay: SDS-PAGE

Purity: ≥95%

Assay #2: SEC-HPLC

Endotoxin Level: <1 EU/μg by LAL method

Activity (Specifications/test method): >1000 mU (1U = 1 µmole/min/mg) as determined by Cathepsin S Activity Assay Kit (K144-100).

Biological activity: >1000 mU (1U = 1 µmole/min/mg) as determined by Cathepsin S Activity Assay Kit (K144-100).

Results: >1000 mU (1U = 1 µmole/min/mg) .

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: ~ 37 kDa

Concentration: 0.2 μM

Appearance: Liquid

Physical form description: A 0.2 μM filtered solution of 20mM MES, 150mM NaCl, 10% Glycerol, pH 5.5.

Reconstitution Instructions: N/A

Background Information: Cathepsin S (CTSS) is a lysosomal cysteine protease of the papain family and may participate in the degradation of antigenic proteins to peptides for presentation on MHC class II molecules. CTSS is synthesized as inactive precursor of 331 amino acids consisting of a 15-aa signal peptide, a propeptide of 99 aa, and a mature polypeptide of 217 aa. It is activated in the lysosomes by a proteolytic cleavage of the propeptide. The deduced amino acid sequence contains only one potential N-glycosylation site located in the propeptide. Compared with the abundant cathepsins B, L and H, cathepsin S shows a restricted tissue distribution, with highest levels in spleen, heart, and lung. In addition, evidences indicated that cathepsin S generates A beta from amyloidogenic fragments of beta APP in the endosomal/lysosomal compartment, and is implicated in the pathogenesis of Alzheimer’s disease (AD) and Down Syndrome (DS).

Amino acid sequence: QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNWILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEIVDHHHHHH

Handling: Centrifuge the vial prior to opening.

Usage: For Research Use Only! Not to be used in humans