Biovision
Human CellExp™ Hemopexin, Human Recombinant
- SKU:
- 26-P1210
- Availability:
- Usually Shipped in 5 Working Days
- Storage Temperature:
- -20°C
- Shipping Conditions:
- Gel Pack
- Shelf Life:
- 12 months
Description
Biomolecule/Target: Hemopexin
Synonyms: Beta-1B-glycoprotein, HPX, Hpxn
Alternates names: Beta-1B-glycoprotein, HPX, Hpxn
Taglines: A blood transport protein that acts as an extracellular antioxidant against hemoglobin-mediated damage in inflammation.
Taglines: USA
Country of Animal Origin: USA
NCBI Gene ID #.: 3263
NCBI Gene Symbol: HPX
Gene Source: Human
Accession #: P02790
Recombinant: Yes
Source: Human cells
Purity by SDS-PAGE #: > 95%
Assay: SDS-PAGE
Purity: N/A
Assay #2: N/A
Endotoxin Level: < 1.0 EU per/μg
Activity (Specifications/test method): N/A
Biological activity: N/A
Results: N/A
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: 51 kDa
Concentration: N/A
Appearance: Liquid
Physical form description: Supplied as a 0.2 μm filtered solution of 20 mM MES, 150 mM NaCl, and pH 5.5
Reconstitution Instructions: N/A
Background Information: Hemopexin (HPX) is plasma glycoprotein belongs to the family of the acute-phase proteins whose synthesis is induced after an inflammatory event. Hemopexin with two four-bladed beta -propeller folds has been found in other proteins including collagenases and provides sites for protein-protein interactions. The liver is the major synthesizing organ. Hemopexin participates in maintaining and recycling the iron pool by utilizing its high binding affinity toward heme composed of protoporphyrin IX and iron. It also functions in preventing oxidation caused by heme after hemolysis. Hydrophobic heme molecules can intercalate into lipid membranes and participate in the oxidation of lipid membrane components through the Fenton reaction resulting in lipid peroxidation. Hemopexin undergoes a conformational change upon the binding of heme. The conformational change allows hemopexin to interact with a specific receptor, forming a complex which is then internalized. Heme concentrations in plasma increase after hemolysis, which is associated with several pathological conditions such as reperfusion injury and ischemia.
Amino acid sequence: TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISE RWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGE CQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPP RYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYW RLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKE VGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSL GPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTHHHHHHH
Handling: Centrifuge the vial prior to opening.
Usage: For Research Use Only! Not to be used in humans