Biovision
Human CellExp™ CHI3L3, Mouse Recombinant
- SKU:
- 26-P1312
- Availability:
- Usually Shipped in 5 Working Days
- Size:
- 10 µg
- Storage Temperature:
- -20°C
- Shipping Conditions:
- Gel pack
- Shelf Life:
- 12 months
Description
Biomolecule/Target: CHI3L3
Synonyms: Chitinase-Like Protein 3, YM1/ECF-L, CHI3L3
Alternates names: Chitinase-Like Protein 3, YM1/ECF-L, CHI3L3
Taglines: Lectin that binds saccharides with a free amino group, such as glucosamine or galactosamine.
Taglines: USA
Country of Animal Origin: USA
NCBI Gene ID #.: 12655
NCBI Gene Symbol: Chil3
Gene Source: Mouse
Accession #: O35744
Recombinant: Yes
Source: HEK 293 cells
Purity by SDS-PAGE #: ≥95%
Assay: SDS-PAGE
Purity: N/A
Assay #2: N/A
Endotoxin Level: N/A
Activity (Specifications/test method): N/A
Biological activity: N/A
Results: N/A
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: N/A
Concentration: N/A
Appearance: Lyophilized
Physical form description: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Reconstitution Instructions: Reconstitute in sterile deionized water to a concentration of 100 µg/ml.
Background Information: Chitinase 3-like 3 gene, also known as YM1 and ECF-L, encodes a precursor protein with 398 amino acid residues with a 21 residue signal sequence. Chitinase 3-like 3 protein is a lectin that binds saccharides with a free amino group, such as glucosamine or galactosamine. Binding to oligomeric saccharides is much stronger than binding to mono- or disaccharides. Also binds heparin and G1cN oligomers, and is produced primarily by macrophages during inflammation. It has chemotactic activity for T-lymphocytes, bone marrow cells and eosinophils.
Amino acid sequence: YQLMCYYTSWAKDRPIEGSFKPGNIDPCLCTHLIYAFAGMQNNEITYTHEQDLRDYEALNGLKDKNTELKTLLAIGGWKFGPAS FSAMVSTPQNRQIFIQSVIRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVKEMRKAFEEESVEKDIPRLLLTSTGAGIIDVI KSGYKIPELSQSLDYIQVMTYDLHDPKDGYTGENSPLYKSPYDIGKSADLNVDSIISYWKDHGAASEKLIVGFPAYGHTFILSDPSK TGIGAPTISTGPPGKYTDESGLLAYYEVCTFLNEGATEVWDAPQEVPYAYQGNEWVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQRHFPLTSTLKGDLNIHSASCKGPYVDHHHHHH
Handling: Centrifuge the vial prior to opening.
Usage: For Research Use Only! Not to be used on humans