null

Human CellExp™ CHI3L3, Mouse Recombinant

(No reviews yet) Write a Review
SKU:
26-P1312
Availability:
Usually Shipped in 5 Working Days
Size:
10 µg
Storage Temperature:
-20°C
Shipping Conditions:
Gel pack
Shelf Life:
12 months
€376.00
Frequently bought together:

Description

Biomolecule/Target: CHI3L3

Synonyms: Chitinase-Like Protein 3, YM1/ECF-L, CHI3L3

Alternates names: Chitinase-Like Protein 3, YM1/ECF-L, CHI3L3

Taglines: Lectin that binds saccharides with a free amino group, such as glucosamine or galactosamine.

Taglines: USA

Country of Animal Origin: USA

NCBI Gene ID #.: 12655

NCBI Gene Symbol: Chil3

Gene Source: Mouse

Accession #: O35744

Recombinant: Yes

Source: HEK 293 cells

Purity by SDS-PAGE #: ≥95%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: N/A

Activity (Specifications/test method): N/A

Biological activity: N/A

Results: N/A

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: N/A

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Reconstitution Instructions: Reconstitute in sterile deionized water to a concentration of 100 µg/ml.

Background Information: Chitinase 3-like 3 gene, also known as YM1 and ECF-L, encodes a precursor protein with 398 amino acid residues with a 21 residue signal sequence. Chitinase 3-like 3 protein is a lectin that binds saccharides with a free amino group, such as glucosamine or galactosamine. Binding to oligomeric saccharides is much stronger than binding to mono- or disaccharides. Also binds heparin and G1cN oligomers, and is produced primarily by macrophages during inflammation. It has chemotactic activity for T-lymphocytes, bone marrow cells and eosinophils.

Amino acid sequence: YQLMCYYTSWAKDRPIEGSFKPGNIDPCLCTHLIYAFAGMQNNEITYTHEQDLRDYEALNGLKDKNTELKTLLAIGGWKFGPAS FSAMVSTPQNRQIFIQSVIRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVKEMRKAFEEESVEKDIPRLLLTSTGAGIIDVI KSGYKIPELSQSLDYIQVMTYDLHDPKDGYTGENSPLYKSPYDIGKSADLNVDSIISYWKDHGAASEKLIVGFPAYGHTFILSDPSK TGIGAPTISTGPPGKYTDESGLLAYYEVCTFLNEGATEVWDAPQEVPYAYQGNEWVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQRHFPLTSTLKGDLNIHSASCKGPYVDHHHHHH

Handling: Centrifuge the vial prior to opening.

Usage: For Research Use Only! Not to be used on humans

View AllClose