Human CellExp™ Dermatopontin, Human Recombinant

Biomolecule/Target: DPT

Synonyms: Dermatopontin, Tyrosine-rich acidic matrix protein, TRAMP and DPT

Alternates names: Dermatopontin, Tyrosine-rich acidic matrix protein, TRAMP and DPT

Taglines: Tyrosine-rich acidic matrix protein that communicate between the dermal fibroblast cell surface and its extracellular matrix environment

Taglines: USA

Country of Animal Origin: USA

NCBI Gene ID #.: 1805

NCBI Gene Symbol: DPT

Gene Source: Human

Accession #: Q07507

Recombinant: Yes

Source: HEK 293 cells

Purity by SDS-PAGE #: >95%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: N/A

Activity (Specifications/test method): N/A

Biological activity: N/A

Results: N/A

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: N/A

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4

Reconstitution Instructions: Reconstitute in sterile deionized water to a concentration of 100 µg/ml.

Background Information: Dermatopontin, also known as Tyrosine-rich acidic matrix protein, TRAMP and DPT, is a secreted protein which belongs to the dermatopontin family. DPT is expressed in various tissues, such as fibroblasts, heart, skeletal muscle, brain and pancreas. It seems to mediate adhesion by cell surface integrin binding. DPT may serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. DPT can enhance TGFB1 activity through interaction with decorin. In addition, DPT accelerates collagen fibril formation, stabilizes collagen fibrils against low-temperature dissociation and inhibits cell proliferation.

Amino acid sequence: QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQS LGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIE YPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANVVDDIEGRMDEPK SCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH

Handling: Centrifuge the vial prior to opening.

Usage: For Research Use Only! Not to be used on humans